PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_859316g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 177aa    MW: 20204 Da    PI: 10.8615
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_859316g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.86.6e-152066147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg+WT+ Ed +l d+++ +G g W+  +++ g++R++k+c++rw +y
   MA_859316g0010 20 RGAWTKTEDMILSDYIRIHGDGEWRNLPQKAGLRRCGKSCRLRWMNY 66
                     89********************************************9 PP

2Myb_DNA-binding37.36.3e-1280114844
                      HHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding   8 EdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 
                      E++l+v+++++lG++ W++Ia +++ gRt++++k++ 
   MA_859316g0010  80 EEDLIVRLHRLLGNR-WSLIAGRLP-GRTDNEIKNYS 114
                      99*************.*********.*********95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.6E-191569IPR009057Homeodomain-like
PROSITE profilePS5129421.741571IPR017930Myb domain
SuperFamilySSF466891.33E-2517113IPR009057Homeodomain-like
SMARTSM007171.3E-101969IPR001005SANT/Myb domain
PfamPF002496.3E-132066IPR001005SANT/Myb domain
CDDcd001671.17E-82267No hitNo description
Gene3DG3DSA:1.10.10.609.3E-1970122IPR009057Homeodomain-like
SMARTSM007171.4E-672120IPR001005SANT/Myb domain
PROSITE profilePS5129412.32972122IPR017930Myb domain
CDDcd001674.67E-880113No hitNo description
PfamPF002494.2E-1080115IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 177 aa     Download sequence    Send to blast
SQPRSLDQNG GYGSKQGLNR GAWTKTEDMI LSDYIRIHGD GEWRNLPQKA GLRRCGKSCR  60
LRWMNYIRPD IKLGNIFPYE EDLIVRLHRL LGNRWSLIAG RLPGRTDNEI KNYSNTRLSK  120
KLPPTNDSEP NSSTQNLKTG SKFLSVVHDH VLKTTPVKTK VVRYSEMVRP NRSKGSG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-211812225128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1094860.0BT109486.1 Picea glauca clone GQ03209_A18 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010666251.19e-63PREDICTED: transcription factor MYB23
SwissprotP102905e-53MYBC_MAIZE; Anthocyanin regulatory C1 protein
TrEMBLF8TJT02e-75F8TJT0_PINRE; MYB-like protein (Fragment)
STRINGVIT_04s0008g01820.t012e-60(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G35550.11e-53MYB family protein